DPCstruct | MC11641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 143 ± 19 aa |
| Standard deviation of domain lengths | 19.35 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0030 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661J439 | 2-132 | QLRLLLGFLGILLIFLSLFMLFPLFFALYYKEDITPLSTSFLITLVVGLLLFLFFRSPKRELRIRDGFALVTLGWITSAFFGALPFY… |
| A0A843FFH2 | 20-150 | NSLLFLCGGILVALAITMAPSLLIAAMKGDSLAIMGVPILIGLMLGAPLVMRYRLATVIRPPDALAMMAVLWITCFVFGMLPFMMCG… |
| A0A5A7NLW1 | 7-158 | None |
| A0A1A9VK23 | 474-598 | None |
| A0A170TKK0 | 2-149 | None |
| A0A316NZ47 | 8-150 | None |
| A0A2N2YWW2 | 7-126 | None |
| Q4W573 | 283-431 | None |
| A0A377LTW5 | 12-154 | None |
| A0A7V4HQT3 | 4-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.