DPCstruct | MC1164
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 80 ± 5 aa |
| Standard deviation of domain lengths | 5.22 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 41.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H5XXF8 | 2-79 | SEFKREDRYLVLKRSDIAKYLGEDDLLELEAMAEEIANRRMDDGRSREMYCVVVEHDWPNYVHVWQTVQQVAEGTFKD |
| A0A7Z9JNX5 | 2-76 | SEFKRERRYLVAKVRDVEAALSDDDKRQLSALMDKVEHHREQQGKPPLECVVVESDWPNYQETWDSVQEVWEANQ |
| A0A4S4AWD5 | 3-86 | None |
| A0A4U0GFD8 | 1-87 | None |
| A0A290ZM79 | 67-141 | None |
| Q5NWU8 | 1-82 | None |
| A0A7V5R7H9 | 22-103 | None |
| A0A7Y3YUD3 | 1-79 | None |
| A0A7T8IPW8 | 1-70 | None |
| A0A348V6K9 | 7-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.