DPCstruct | MC11639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 110 ± 10 aa |
| Standard deviation of domain lengths | 10.36 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 28.11 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | PF07541- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843E717 | 36-142 | YSGDWVETFIEVAVDNVTPPFVQIDGILELTSRAADGVERIRAALMKGLEVAEDSNIEITSVGSPRYRIVITADEYKDAEEIMKKVS… |
| A0A640W671 | 49-155 | FEGKWMEKFIEIAKENIPPPIVEIAGYVEMTCFKSDGIKYIKEALKKMEGKFDGAEARVRYVSAPVYRIEVIAPDYKMAEKIMKQQV… |
| A0A094I2U0 | 221-347 | None |
| A0A1I8IBH7 | 5-112 | None |
| A0A7C1KX75 | 45-153 | None |
| A0A843DK39 | 85-185 | None |
| A0A7J4K4Z9 | 1-105 | None |
| A0A834T7I0 | 179-300 | None |
| A0A0G4KCG2 | 166-275 | None |
| A0A7T9DJN5 | 192-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.