DPCstruct | MC11638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 149 ± 10 aa |
| Standard deviation of domain lengths | 10.16 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K4CG83 | 56-193 | HMVRTANHDNFGLAILIFQLLFLGRHPYAGVYSGKDDMPIERAILEFRYAYGKNAGARMMAPPPNSVGPSIVPGDVAELFEIAFSEA… |
| A0A843E6V3 | 9-157 | APTFTRSSDNFALAIHIYQLLMNGTHPFQGALRPGVDEVLPGIRENILSRTVPSMGECSRNIIPPSYSPSFTSLPLELQTLFGRAFL… |
| A0A7C3J7B8 | 192-342 | None |
| A0A351CRI6 | 36-190 | None |
| A0A6V8KYV6 | 5-164 | None |
| A0A3L7VZ26 | 110-240 | None |
| A0A285KAB8 | 188-328 | None |
| A0A414C9U1 | 20-162 | None |
| A0A831PDS2 | 212-369 | None |
| A0A317F926 | 214-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.