DPCstruct | MC11637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 237 ± 23 aa |
| Standard deviation of domain lengths | 23.18 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0472 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843DT43 | 3-228 | IMVIIDSKEFFKGGDKYVERASKTPWYWIGVLFGSTLVLESAMIVLLHLAGADVKVPDPLANLDFTEALYEYSFAGVWEEIVFRMVL… |
| A0A497L383 | 186-433 | LFTALIVASWAWRGGFHNRVLGGWREPFLKNLRNPLYALPFIATATLTGTVLLTLLMEHLGVGAGLTVELPGPLLVLLETTYAAVVE… |
| A0A846NMI1 | 50-306 | None |
| A0A2H5VFN5 | 45-278 | None |
| X1RBS0 | 4-213 | None |
| A0A662MJI0 | 230-430 | None |
| A0A534K1B7 | 347-614 | None |
| A0A537HJG4 | 2-234 | None |
| A0A7C4TM79 | 11-294 | None |
| A0A662M8Q6 | 524-750 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.