DPCstruct | MC11636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 51 ± 2 aa |
| Standard deviation of domain lengths | 2.23 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 91.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 47.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J4XII2 | 3-52 | HILKCISCGNYTLKEKCKCGCKAVTPKPAKYTPEDKYGNYRREAKKDNLI |
| A0A843CYP6 | 1-55 | MKSDIRKCNKCGRYTLSQICKDCGCTTICPVPPKYSPDDRMGEYRRRSILEEYGE |
| A0A497SUI4 | 44-94 | None |
| A0A147JZ39 | 1-53 | None |
| A0A831U481 | 18-70 | None |
| A0A2R4ZMU9 | 2-52 | None |
| A0A7J3D3U4 | 1-50 | None |
| A0A832JJU7 | 5-57 | None |
| A0A1J4UPL3 | 12-60 | None |
| A0A1D2RFM1 | 1-52 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.