DPCstruct | MC11632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 73 |
|---|---|
| Mean domain length (aa) | 316 ± 55 aa |
| Standard deviation of domain lengths | 55.00 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 39.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A120IPJ9 | 2-294 | LRWITAGESHGRALVAVVEGMVAGVHVTSADIADQLARRRLGYGRGARMTFERDAVTVLSGIRHGSTLGGPIAIEIGNTEWPKWETV… |
| A0A3M1HEB1 | 431-761 | AMGVALKTYFYGDSHGKRVGFFMDGMPSGIEVSPSFVEEELDKRRSKSKLTTPRREEDKPIIISGLSANKTDGNRVRVEIRNKDTHS… |
| A0A660X9T0 | 2-283 | None |
| A0A4S4EBH6 | 91-383 | None |
| A0A7C6ZGR9 | 11-338 | None |
| A0A656D9E7 | 8-301 | None |
| A0A5A7QUA9 | 57-505 | None |
| C4KWI2 | 85-430 | None |
| A0A0M8MMP9 | 485-831 | None |
| A0A395IW04 | 10-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.