DPCstruct | MC1163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 64 ± 5 aa |
| Standard deviation of domain lengths | 4.87 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 40.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3MX35 | 5-69 | QTGVPVRGDYVFHPDTWHSIELNVRHPVPEWGGQEVRFALEEDAAILADGWDWIDGRQTEFYLIR |
| A0A2V9IYH6 | 168-236 | MVDYQNGVPGRGDYIFWPDTWHSIELNVLHPVKEWDNQPVRFALEEDAALLPSGWDWIDGRQTQFYLIR |
| A0A524A2T9 | 1-61 | None |
| A0A1Q7SX30 | 32-97 | None |
| A0A7X4E102 | 1-52 | None |
| A0A7C1N6M9 | 19-81 | None |
| A0A1Q8AVJ1 | 40-101 | None |
| W3X7S2 | 4-70 | None |
| M7NR92 | 12-75 | None |
| A0A167GWU2 | 4-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.