DPCstruct | MC11629
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 235 ± 21 aa |
| Standard deviation of domain lengths | 20.94 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 14.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A076F034 | 1-194 | MNVEFDLDGDELGGILELNTVLTLRRSTAGASKAAARRPGSVLWNDKFSIRLQGDAVLFPLAIADFHDLPYPTKASWYLEVGEDLEA… |
| A0A0N8HY67 | 1-226 | MVVKAKSDSTKADILLLDAAAPADANVPVPLHLDVPGTELGGRLTLTTFILVDASVPLDPLAPHQRGSILWKHSAHVYLQGIGAQFP… |
| A0A448VRE1 | 36-287 | None |
| Q1PLC3 | 41-308 | None |
| A0A1C4TDH7 | 2-225 | None |
| A0A7T3KTU0 | 5-257 | None |
| A0A1H3YVU4 | 105-325 | None |
| A0A1E3X3V0 | 3-253 | None |
| A0A410G0S9 | 32-255 | None |
| A0A2Z3Z3Q4 | 13-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.