DPCstruct | MC11627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 230 |
|---|---|
| Mean domain length (aa) | 124 ± 24 aa |
| Standard deviation of domain lengths | 24.04 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08881 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0SDE2 | 3-100 | FQMSSCNIRLGGSVLHADCKNTPGDWIKTSLDLNEHIGNRNGRFTLCDRDWYHSARNVQLIGSKLKAELAKEGGEEWVESILDLNLC… |
| D8T646 | 136-265 | QGMPGCCCFPWRSRNDRDECGFFSRTCQNYRISKLGYFWATCYKEDRAYTKHWFIVLNEYVENVNGELKPGGSEFSRTCSQLRIIRF… |
| A0A1X7AQ98 | 178-329 | None |
| A0A495DEI5 | 165-363 | None |
| K9V1P0 | 24-160 | None |
| S3CBP1 | 1-188 | None |
| A0A194V6H8 | 1-137 | None |
| A0A2V5ICK6 | 25-157 | None |
| A0A5N6EM92 | 2-119 | None |
| A0A6A5ULE7 | 23-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.