DPCstruct | MC11626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 67 ± 2 aa |
| Standard deviation of domain lengths | 1.91 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 92.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 60.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8T2R6 | 1-64 | MICLTLQAELDSEGAYMYNAAVALRDTMIELEVAIDSGKDSLSMAAQAGGETVKAHGNLVLSRM |
| A0A1W0WAJ6 | 69-134 | DVKCSGNWMWPAKLPGEGAALYDACEAMCGVMKELGIAVDGGKDSLSMAAKCGDEIVKAPGTLVIS |
| A0A183F3K1 | 48-115 | None |
| A0A5S6QT58 | 39-108 | None |
| A0A6T6X0A2 | 197-264 | None |
| A0A0V0RYY1 | 93-162 | None |
| A0A3P7M1Y9 | 2-68 | None |
| A0A540NNK4 | 23-90 | None |
| A0A103XQP0 | 128-193 | None |
| A0A2A2L253 | 556-621 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.