DPCstruct | MC11625
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 131 ± 20 aa |
| Standard deviation of domain lengths | 19.88 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 19.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8T273 | 13-147 | LCIMLNGRIAEIFRRFNITGDLKAAVLHLMESSGKDEDPILVIVWNPAELQRIAGPKQGKAQILQAFSNAAGCSRLPAGYPCEDQVF… |
| A0A397V0H7 | 10-159 | LPSLESALKTIFPNASDNLISNYKKHLDDVDELDPVLIITPNMAWINQHGWNNYDAIMDLFATHGLTNQRRDKNTRCIFHFGELDDL… |
| A0A433DL12 | 57-201 | None |
| A0A372Q9Z9 | 7-114 | None |
| A0A2Z6RDY3 | 4-130 | None |
| A0A397I9U6 | 1-124 | None |
| A0A397ITK3 | 49-199 | None |
| A0A397J3F1 | 41-162 | None |
| A0A2N1N622 | 25-170 | None |
| U9SX46 | 39-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.