DPCstruct | MC11624
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 134 ± 16 aa |
| Standard deviation of domain lengths | 16.32 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 50.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7IB21 | 1-110 | MTYFPVKDFVGNGALKGILPKLLKEGWDNVRNLKLMRSEDMDAINMTQQQKDALEMRSYLYDRALMQYGDKLEDSGKSLAKLLELSN… |
| D8SQI0 | 85-207 | HKMQTLEEYLGNGVLAGSSKIFTTNGYDDVHSLKSMTKNDMKSLGLTKQQQNALELRAFLDDHGLFEYADALEATGKTLADLRRGSS… |
| A0A834TX38 | 5-139 | None |
| A0A6A2XRR5 | 598-705 | None |
| D8RT37 | 3-129 | None |
| A0A7J6WVS2 | 1-123 | None |
| A0A7J7HXP5 | 1-158 | None |
| A0A200R2D3 | 1-162 | None |
| A0A6N2MWA1 | 5-157 | None |
| A0A2P6R278 | 1-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.