DPCstruct | MC11623
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 187 ± 15 aa |
| Standard deviation of domain lengths | 15.11 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 39.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D8SN07 | 33-218 | ENSSSNPVAKLVSSLPIVGLFMRILSDEGGIGGDRVDFPDFYTRVQKRCPEDASGAFARFVERHGKVAKPMFVLVWCWVAAVGAGLL… |
| A0A2P6VSD2 | 1-184 | MAKRAVGALPIIGLISRLTATEGGIGNDAQAYPEFCRQVFDAAPQGFQIAVAELQDRHGKAAQRKYVLLALWMARHGGGIVPGKAIV… |
| A0A699GH73 | 597-777 | None |
| A0A7S2Z0A0 | 68-252 | None |
| A0A6A6M9C2 | 1-172 | None |
| A0A835UBB2 | 1-166 | None |
| C1E2D8 | 2-168 | None |
| A0A7J0FBD8 | 3-189 | None |
| A9NNS3 | 65-262 | None |
| A0A0E0L4U8 | 90-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.