DPCstruct | MC11621
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 285 ± 45 aa |
| Standard deviation of domain lengths | 44.77 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 33.20 |
| Pfam Score | 62.68 |
| Assigned Pfam label(s) | PF04652- PF14288 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287VW43 | 2-246 | YAFEKAHRLDQNSVGRGVRQFKTSLLQRLEKDNSPSLAKRLKKADAREIESFYQEYYENYVRTLDKGEQADRTQLGKAYQTAGVLFE… |
| A0A3B6QP16 | 1-287 | MASSSSIVQVVSESTLDSDVVPSSLIEIAPFLRVANEVEAINPRVAYLCRFHGGFEKAHRLDPLSNGRGVRQFKIALLQRLERENDP… |
| A0A2P2MBJ8 | 14-356 | None |
| A0A6V7PX02 | 20-298 | None |
| A0A6V7PWG3 | 164-451 | None |
| A0A7J0G3C7 | 29-337 | None |
| A0A453Q8E9 | 2-294 | None |
| A0A287PYJ5 | 9-357 | None |
| A0A453Q8Q3 | 2-291 | None |
| A0A2H5PHZ4 | 18-297 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.