DPCstruct | MC11620
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 166 ± 27 aa |
| Standard deviation of domain lengths | 26.98 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B6QLZ0 | 2-149 | QFKRALLKSLLLGLRESGVASREMGFLERKGAIRRAADVALASARGSDATRWSQALETQRRPSTSKRILRRCHRPRPRKAGTAARPR… |
| A0A068U5Y0 | 10-131 | IRTRLAYRFLRALKKLNKQRTDTCRRYHMVKMAAYASMASAVGSKRAWSRALLWKIRNRGLNRWLVKRNKSLGLEEAHQELRKLVPG… |
| J3MGE5 | 2-170 | None |
| A0A4D9A1Z5 | 8-185 | None |
| A0A426XYP6 | 17-180 | None |
| A0A426YE21 | 2-149 | None |
| A0A833VXM8 | 4-143 | None |
| A0A022R0R2 | 8-189 | None |
| A0A368Q9F7 | 72-233 | None |
| A0A1D1YTV4 | 13-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.