DPCstruct | MC1162
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 77 ± 8 aa |
| Standard deviation of domain lengths | 7.76 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 93.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V2A2L9 | 596-679 | NVAESLRDAMAKNPHLKVYVGCGYYDFATPYFIAQYDVEHMFLRPELRKNVKFYFYESGHMYYIHKPSLIQFKKDTDSFFDWSK |
| A0A534AVP8 | 10-85 | ALVQDANLRVLVLNGYYDLATPFSATEYVMTHLGVPPGTSSRIQMKYYEAGHMMYVHPPSLKKMKGDLDTFIDSTV |
| A0A3E0NPL2 | 556-638 | None |
| A0A7C3BBI4 | 188-271 | None |
| A0A7V5CTD2 | 286-366 | None |
| E6D4Y4 | 143-210 | None |
| A0A1A7QFM5 | 1-64 | None |
| A0A1H0MHW2 | 53-137 | None |
| A0A2A2K8P3 | 629-704 | None |
| A0A7T7BFT8 | 2-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.