DPCstruct | MC11619
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 152 ± 33 aa |
| Standard deviation of domain lengths | 33.26 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 90.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 28.50 |
| Pfam Score | 84.49 |
| Assigned Pfam label(s) | CL0323- CL0010- CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8A7BCS7 | 2-111 | QPTLRELAALGARCGVEGRVFGSLAWQTLTGERYLSDGSDLDVVFPLPAAALRDALLDGLAALDARAPMRIDGELLRDDGAGVNWRE… |
| M5CJT1 | 14-156 | LRVPARDVLRTAPPPSLHTVLEGSVARDWQRPLQALHGIAAAHVFGAFAWQHLTGLHYVHARSDIDLLWRIDTIAQADALVARLLAW… |
| A0A6N7KRU7 | 197-376 | None |
| Q8PPW9 | 27-206 | None |
| A0A6M4H260 | 19-172 | None |
| A0A4Q4X6T3 | 160-325 | None |
| A0A7X7MIV7 | 15-171 | None |
| A0A1V0VSU0 | 50-259 | None |
| A0A7C6UN75 | 44-218 | None |
| A0A1M3CX66 | 28-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.