DPCstruct | MC11618
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 90 ± 10 aa |
| Standard deviation of domain lengths | 10.38 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0315 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A091CC26 | 2-79 | VALFTALTVIGTMIKIPLPTGAFVHLGNAVLLLSVLLLGYVKGSLAGGLGFAIFDILNGYAAEAPYFIVESFIVGAVA |
| X1CR21 | 199-275 | IGIFAAFTCILTFIVPITIPATQGYINLGDIGVMISGLLFGPIIGGIAGGFGSALADLFIAPIYAIPTLIIKGLEGF |
| A0A7J3IJ41 | 6-89 | None |
| A0A5B9DAK0 | 10-129 | None |
| X1D868 | 11-101 | None |
| A0A7X9NQ04 | 4-97 | None |
| A0A4T9WH12 | 8-89 | None |
| R9IYI7 | 1-89 | None |
| A0A842P0G9 | 4-84 | None |
| A0A845KTW1 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.