DPCstruct | MC11617
Metacluster Properties and Pfam Annotations
| Number of structural domains | 110 |
|---|---|
| Mean domain length (aa) | 97 ± 15 aa |
| Standard deviation of domain lengths | 14.56 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.31 |
| Pfam Score | 95.56 |
| Assigned Pfam label(s) | CL0010- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X1CQZ0 | 8-99 | EITTDKPEKSLTVGLKKRGGRNNQGRLTVRHQGGGSKRKYRIIDFRKQKEGIPAKVSSIEYDPNRSARIALLKYYDGEKRYILCPEN… |
| A0A2U3DZ60 | 298-392 | DHLWKGRPFLPLTIPKKGQAKGGRNVYGRITVRHRGGGAKRRIRTVDFERWRPGPHLVERIEYDPGRSAHIALVTEQATSRKSYIVA… |
| A0A1S3UJN2 | 1-87 | None |
| A0A6V7H5Q0 | 73-177 | None |
| A0A0A2V2L9 | 81-175 | None |
| A0A4S8I320 | 18-100 | None |
| A0A7N0V7V6 | 18-125 | None |
| A0A7N0UUW0 | 4-96 | None |
| A0A2C9WPI3 | 21-103 | None |
| A0A411K5D6 | 120-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.