DPCstruct | MC11614
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 144 ± 16 aa |
| Standard deviation of domain lengths | 16.15 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 25.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2XFL1 | 355-483 | WSNTGNLLVGNRGTGSLNITAGGSVDNQVGIVGNESTGSGSAMIGGGTGSSGWTNRAHLVVGQSGAGSLAIVGGGTVTSTVGYIAYD… |
| A0A6D0F6Z6 | 19-152 | WNFLGTGEAFRYIYIGDAGDGELNVSSEGKVDSGIITAGMKETGTGNITVKDKNSVITNLGTNLGYDGHGEMNISNQGLVVSNGGSS… |
| A0A518AQC3 | 529-676 | None |
| A0A838R2F9 | 1-169 | None |
| A0A2N9VRQ4 | 246-370 | None |
| A0A2U0UY41 | 95-260 | None |
| A0A1G2ZSY1 | 313-452 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.