DPCstruct | MC11612
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 87 ± 18 aa |
| Standard deviation of domain lengths | 17.93 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A533B682 | 1-61 | MRRFTRLTNAFSKKVENHIHSVAMYVMFYNFCRIHRTLRATPAMAAGVSDHVWSIEEMVGQ |
| A0A534Z2T6 | 7-84 | MELVSTSYVERQNVTIRMQVRRLTRLTNAFSKKAENLKATMDLHFTHYNFVRFHRSIRCTPAIEAGVASSPLTVKDLV |
| A0A3N5QR47 | 292-402 | None |
| A0A512JRI8 | 52-127 | None |
| A0A523FC71 | 4-64 | None |
| A0A850T2H9 | 14-128 | None |
| A0A0F9H7F9 | 77-176 | None |
| A0A1Q7FR85 | 114-210 | None |
| A0A7J2SQI6 | 1-99 | None |
| X0SBJ0 | 2-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.