DPCstruct | MC11611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Standard deviation of domain lengths | 6.93 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02576 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534Y6G6 | 8-83 | LEKVRNIAAPLAAAEGLELVDVEFAGPGGHPTLRLYIDKVGGGVTLDDCTQVSRALSAALDVEDPIEGSYELEVSS |
| H1PQ49 | 25-104 | ENILKKIETIVTPVVNEMELSLVDIEYLQDGGYWYVRIYVENPEGDITLEDCAAISNKIDEDIDKLIEQRFFLEVSSPGI |
| A0A2G9Y0Y1 | 12-93 | None |
| A0A2G6GUM1 | 1-91 | None |
| A0A1G3L3B1 | 4-85 | None |
| A0A5S9Q2P4 | 36-110 | None |
| A0A017HLH3 | 11-84 | None |
| A0A7C2WRC1 | 1-68 | None |
| A0A1G0I673 | 18-97 | None |
| A0A091AWP9 | 5-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.