DPCstruct | MC11610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 260 ± 18 aa |
| Standard deviation of domain lengths | 17.72 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y4IUU6 | 1-235 | PEEDEAPRFLKRELPRPRGRFTRVEAQRLSFLELTRAEGKETLEAAIEATEHRYSLLRTLEHRYNGPRGEMTQVDMENVLRQHGIME… |
| A0A534Y5T0 | 50-304 | DELQAELDDLGIRRKAFRLVRGVPGDVPRARQLPGVASGPPVRRRAHPPEPAATLGAPPEATAPPAEPSAAPDVAAQAKKLRTLLGE… |
| Q2II58 | 77-331 | None |
| A0A7C4PRW3 | 197-454 | None |
| A0A2W4L740 | 47-338 | None |
| A0A1L9BHE2 | 122-395 | None |
| A0A534PRL1 | 7-240 | None |
| Q1D636 | 248-534 | None |
| A0A3N5GVU8 | 91-351 | None |
| A0A1F3C2A4 | 105-362 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.