DPCstruct | MC1161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 97 ± 8 aa |
| Standard deviation of domain lengths | 8.43 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0141 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A534ABI6 | 16-110 | VAVTGWKLIGFLGVFLFTARWFVQAYATKKMKRVTVPMMFWYLSVAGSVLQLAYFVWGKNDSVGIMNTAFPMLVSVYNVVAHLRYHK… |
| A0A2D7BIP0 | 30-119 | LPETLPQQPETVMIAVGFGGQLLFAMRFIVQWITSEGAKRSVIPVMFWYFSIGGGMVLLLYAIWRQDPVIICGQGLGLLIYARNLIF… |
| A0A1V5FLR7 | 123-229 | None |
| A0A7V2XIZ6 | 62-152 | None |
| A0A832H5H8 | 32-122 | None |
| A0A3M1H2B7 | 34-140 | None |
| A0A7K3WSM9 | 114-210 | None |
| A0A1V6EXG6 | 66-170 | None |
| A0A518BH37 | 95-210 | None |
| A0A7X0QM63 | 6-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.