DPCstruct | MC11609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 86 ± 8 aa |
| Standard deviation of domain lengths | 7.86 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 27.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0UHB9 | 4-83 | IQIIDRISYIAFANFFLFMIMSSVIGGDALSGFVKDEEYFVSDYGEYAQVDIFTWYLSRTLGLGALVFMPFAITLKFSHY |
| A0A534XZH5 | 18-98 | ICNALIALAAIHFVVFVVTIVVLGGDALTGRVEDGHYFLGNHGLMVETSRAAWHLSAIIGRSLVYGTFPLGVIAALLRPRK |
| A0A6A7MYG9 | 1-80 | None |
| A0A848Q902 | 21-101 | None |
| A0A443L6T7 | 16-98 | None |
| A0A7C3SIF5 | 4-96 | None |
| A0A7V2FZ92 | 5-104 | None |
| A0A222F3H9 | 1-94 | None |
| A0A844D282 | 2-82 | None |
| A0A2N2PCK7 | 5-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.