DPCstruct | MC11608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 176 ± 19 aa |
| Standard deviation of domain lengths | 19.10 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B9XWM3 | 70-218 | TDFLKNQGTLVSIIENTINGELNYGASKVSSKNSYYRIVMDYTKYKNHHTKFGEAKVGVGLRLVAKVKTSNNKVNLGDLFALGLAAE… |
| A0A2G2H8A6 | 54-245 | YAGMTVPTENLFPVRQEDAPQDKRITITVDHLDRWDVQSHQYTSKAEVEGSLLGRLFSSKAESATHGIVQEAKRFCAIPTAEGRTMQ… |
| Q5LMH6 | 27-209 | None |
| A0A7Y0AEM1 | 65-248 | None |
| A0A257WS24 | 21-193 | None |
| A0A4U1BMG8 | 29-247 | None |
| A0A6L7GD56 | 28-190 | None |
| J2KDL1 | 102-255 | None |
| A0A6N6JM79 | 7-184 | None |
| A0A6P2J8Z4 | 2-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.