DPCstruct | MC11607
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 53 ± 8 aa |
| Standard deviation of domain lengths | 7.63 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 52.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D8YG34 | 7-54 | SSNKTVRKRDLPQKMCPVCQRPFSWRKKWESVWEEVVYCSRACRQKGR |
| A0A3R7UJP8 | 1-38 | MPSKTCLQCSKPFNWRKKWERDWDNVQFCSKKCRGEHQ |
| A0A383WDJ4 | 31-100 | None |
| C1EAQ8 | 61-113 | None |
| A0A7R9WE74 | 110-160 | None |
| A0A5J4YN36 | 441-493 | None |
| M1VD95 | 1-52 | None |
| A0A7V8ZK68 | 159-209 | None |
| A0A0G4HKK3 | 1-47 | None |
| A0A7S2XL41 | 70-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.