DPCstruct | MC11605
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 194 ± 34 aa |
| Standard deviation of domain lengths | 33.98 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 91.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 17.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17338 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A7ALF5 | 16-196 | IKSISMPRIKTFAPGVPCAKTCYVSHFDWRTTVRNAYDNNLNLWLTDPDGFEVQATAAAYGSFYFRWHVSGDIVDERYFDMMCRIAT… |
| A0A6N7L065 | 10-185 | NVCSQAGACASLCYARVGAYRFKNVRAAHIRNLLLCRDSPEEWEERMAKELTHSRYDGKWIRLHDSGDFFSDDYLSAWMRIMRGAPN… |
| A0A4P2R4J4 | 37-291 | None |
| A0A497B5F5 | 5-150 | None |
| A0A416L7E3 | 43-253 | None |
| A0A518K617 | 44-259 | None |
| A0A846PJM7 | 5-213 | None |
| A0A350NZM9 | 160-336 | None |
| A0A420WGT0 | 51-261 | None |
| A0A396C6W0 | 7-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.