DPCstruct | MC11601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 192 ± 18 aa |
| Standard deviation of domain lengths | 17.80 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N4XSS9 | 125-299 | KGLLFCLSSLDTEKEYDLAQHINNDIDFGTNKFEEIFLVDNKRATFLVSSIKTAESYWPLSEIKFLYQNTGKNMEKSQLLLSGKKLP… |
| A0A7S8XFI4 | 4-204 | IIDCSKVSPEINSAISSFTCQKQKRHFGVLFWWHGNKEQIDRDIKQDLSAMQIELGAKHPIYLVDMARATFIKDALTHFKSSIHAPY… |
| A0A0T6VE19 | 2-211 | None |
| A0A7L8BGY9 | 2-151 | None |
| A0A1E4WLB3 | 33-238 | None |
| A0A7Z7AW06 | 104-293 | None |
| A0A7G2SE24 | 97-317 | None |
| A0A3M5FEH5 | 3-187 | None |
| A0A4Q6CX90 | 30-233 | None |
| A0A3M4U8D4 | 2-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.