DPCstruct | MC11600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 85 ± 11 aa |
| Standard deviation of domain lengths | 11.36 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 36.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D6CV13 | 11-98 | LANMFELAPVSLWVEDFSAVRRLLSMLREQGITDFPTFLRVHPEFIDRCMQEIRVLDVNHQTLSMVGASDKPRLLRNLQHVFRDDMRV |
| A0A6A5L3N0 | 237-311 | YARGVFEHAPVSLWVENFSTIKMLLDEVRMQGITDFRTFTDVHPEFVERCMQEIQVLDVNGFTLEMFKARNRNDL |
| A0A3N5SAF0 | 537-620 | None |
| A0A7C0ZUD8 | 383-490 | None |
| N9MBD3 | 8-86 | None |
| A0A1T2L2R1 | 426-500 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.