DPCstruct | MC1160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 192 ± 24 aa |
| Standard deviation of domain lengths | 24.02 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B0DLE8 | 20-227 | GSPVTTPPINLSSDPLYAVNVKDKPTMALALSVEFPTVGAQYVNVPDTNSDDSYANTKEYLGYYDAESCYRYNDAPTETPESGRTSA… |
| A0A534A250 | 29-210 | GASVVGAAALSDIPVYSASNVPANLMLALSVEFPTGTVAAYTGASDYSASFSYLGYFDNAKCYDYDTTNKYFVPSGSASSGCTGHWS… |
| A0A6I2KFD8 | 1-175 | None |
| A0A431KBZ8 | 27-249 | None |
| A0A318CSM1 | 1-193 | None |
| A0A838ZVK6 | 14-161 | None |
| A0A533XNR2 | 1-229 | None |
| A0A364NLE5 | 1-195 | None |
| A0A1E8PNV3 | 1-200 | None |
| A0A0Q8PZK4 | 1-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.