DPCstruct | MC116
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 108 ± 17 aa |
| Standard deviation of domain lengths | 17.47 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17428 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I1F926 | 1-77 | MSTESPDEAYSIDFYSWDQGATGSFGIRGELQGPLWFKKAIYLEEEVDNVKVNWKSNSMIEINGKQLELKNGETYGY |
| A0A4U2YEF8 | 3-99 | LLPFSLYYIAFYSTLLIGEGELTNEVYSPNSQYVAKVYRVGDEGGLRVDVNTGLFGSERLIYWSWKETEEKVKWLDDTHIKINERVL… |
| A0A4R3L7Y8 | 79-181 | None |
| A4XJK3 | 30-135 | None |
| A0A174A237 | 17-122 | None |
| A0A6A7KAY2 | 4-96 | None |
| A0A3N6A886 | 3-86 | None |
| A0A7X9R6C2 | 42-154 | None |
| A0A841JVK3 | 10-118 | None |
| A0A285CQK5 | 28-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.