DPCstruct | MC11597
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 120 ± 16 aa |
| Standard deviation of domain lengths | 15.55 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 28.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2ZZV2 | 1-106 | MPIIEPEIIKAGEKELLSSMLASFDEYQIEKLFQETHSLILKEKMQFKGGKTLVFNNQISYQFDYSSIAAFPVLLNEMGKFMGFANP… |
| A0A2N2JYF0 | 1-116 | MKITSLDVIKNGERDLMDAITADLDWSAVETIFRERHNLSIEEDIEYKRGDIVVHNEQVAYRLDFVAKVTLSVLLDRDGNHLAVDIA… |
| A0A1W9WRU2 | 1-128 | None |
| A0A1W9THG5 | 6-146 | None |
| A0A661SI44 | 1-107 | None |
| A0A2G6MR77 | 1-119 | None |
| A0A7W0HK08 | 1-103 | None |
| A0A3N5REX7 | 1-130 | None |
| A0A7V7DTF2 | 1-138 | None |
| A0A4U8YT77 | 19-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.