DPCstruct | MC11596
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 184 ± 13 aa |
| Standard deviation of domain lengths | 13.10 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672T841 | 1-187 | MATVPVYCICRLPYDVTQFMIECDACKDWFHGSCVGVDEDEAPDIDIYHCPNCEKTHGKSTLKKKKSWNKHDTGQSGDVRPVQNGSQ… |
| A0A2T9YKN7 | 1-162 | MTKRKERCLVCNKVYPNNKTSTSQTDLWIQCDQCNGWIHESCSELTDSQVVKIEAYKCIKCINENQKGMKRKSSRTSGKVDYRMLND… |
| A0A821LQB2 | 248-436 | None |
| A0A0E9N9V1 | 8-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.