DPCstruct | MC11595
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 258 ± 39 aa |
| Standard deviation of domain lengths | 39.43 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 23.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1J0U4 | 5-244 | SKTNSFDKLDTKSLELIFVLSGNPELSKVSRKLFRISHCVKTQVKYMLRNVYPKDEFIRYIFYSKYPKLARKDDIALELMNQGVDIH… |
| A0A2T9YI92 | 9-294 | KESPFGKLNEYTLEHIFILSKNPELSKVSMQLYKISQKTSTQVKYLIRNVHSKTGFLQSIFYSRYRKLAKKEELVIELVSKGVEVKQ… |
| A0A1R0GNQ0 | 4-278 | None |
| A0A2U1J941 | 72-363 | None |
| A0A2U1J8C0 | 26-303 | None |
| A0A2U1J631 | 4-285 | None |
| A0A1R1PX02 | 1-306 | None |
| A0A1R1XJ01 | 1-184 | None |
| A0A1R1PDS8 | 1-224 | None |
| A0A2T9YZB8 | 10-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.