DPCstruct | MC11593
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 90 ± 4 aa |
| Standard deviation of domain lengths | 4.29 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816DZN9 | 1-91 | VKPALRRDARNCIEFSLINSETNERAPPCLITGYPVLADCVIFDRYNLMANKEDWNKFVLSAKSIRRETLQDCLKFLAKWTGTQPNK… |
| A0A1J1I9K9 | 192-279 | DQKVDQTLPTDDRNLYESSLGIGDAACLISGYPVLGRQPITFQRSSLLANRDIWSKLTVAAKMSPHTDAPDVIEFLEQWQGPANYINN |
| A0A654H4R0 | 524-610 | None |
| A0A820TC57 | 490-584 | None |
| A0A6L5DA37 | 115-199 | None |
| A0A6P3RNW5 | 5-95 | None |
| A0A177BAW8 | 603-694 | None |
| A0A4Z2BQJ5 | 155-239 | None |
| A0A094ZML6 | 29-118 | None |
| A0A7J8FHH7 | 709-803 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.