DPCstruct | MC11591
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 88 ± 7 aa |
| Standard deviation of domain lengths | 7.30 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 40.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815Y6S8 | 1-79 | MAPEILTCQPGPKCYLDYSKSDLWASGTLCYEFFSQKNPFFHGLLRQDNYDDEKLPSLSSKAPPIIEQLVYSMLRKNPE |
| A0A0N4ULK3 | 373-465 | YTNDEVNLGGNLSLRAPEVRRAVPGIGHFVNFSMADLWAAGTIGYEIFTRMNPFYKQMKSYDYMEFELPQLPRRIHYAVKMIIREML… |
| B4NU31 | 118-209 | None |
| A0A444SSQ5 | 69-157 | None |
| A0A7R8X2T8 | 451-533 | None |
| A2AM76 | 1-82 | None |
| A0A158PDJ7 | 207-300 | None |
| A0A1I8EVZ2 | 41-135 | None |
| A0A6G0UPT3 | 382-458 | None |
| A0A6I9X4C5 | 24-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.