DPCstruct | MC11589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 63 ± 2 aa |
| Standard deviation of domain lengths | 1.54 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 80.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 78.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A816D7U8 | 187-250 | FKDANNRNTFIHTGLQVDSMHFNAEAASQNKKPVQCYICLQYNHVAKYCKTKQQICAKCGDNHR |
| A0A815XTZ9 | 1-59 | NAFIQTSLQIDSMHFPAEPATQNNKPVQCYLCLQYNHMAKYCKTKQQVCARCGGKHHVD |
| A0A819B9F7 | 111-173 | None |
| A0A819B4S7 | 648-711 | None |
| A0A819AS90 | 143-205 | None |
| A0A818Y4J4 | 304-366 | None |
| A0A814R9E8 | 33-95 | None |
| A0A820QXM3 | 124-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.