DPCstruct | MC11586
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 147 ± 18 aa |
| Standard deviation of domain lengths | 17.66 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E3BZE1 | 89-227 | SYWYEGYLPQAIETEELLFVEDSGGFREGCGAAIYKMNGLSLERIRTNGLDALRDAKQARRHKAREYSDWKETPYIEPKDEIVRNGW… |
| F4QTN2 | 53-191 | LPSGLEAGAVVSGSVDRTLTYETGLIVFELPDAFAVKIGNRGLSALNQLPKTSRGSRSTYGPWQETPVIKKSTADVDAYSNYSFDAL… |
| A0A7L8TZA4 | 4-138 | None |
| A0A142LYU5 | 1-118 | None |
| A0A7W5TFC7 | 50-229 | None |
| A0A1Z4C143 | 3-158 | None |
| A0A3D4MEV5 | 160-324 | None |
| A0A1W6L4T3 | 50-204 | None |
| A0A1G3I7K5 | 22-187 | None |
| A0A2S9QCI3 | 6-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.