DPCstruct | MC11581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 113 ± 17 aa |
| Standard deviation of domain lengths | 16.75 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.27 |
| Pfam Score | 91.15 |
| Assigned Pfam label(s) | PF16898- PF00521- CL0413 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820PZH8 | 1-93 | MAKEAKEYFSNVDRHHIIFKYDSIKDDLAIQLAFNSALSDDRKDWIKWHTEDINQRREQNLPADYLFKKDTKQINFNDFINKELVLF… |
| A0A182EZ74 | 15-122 | DYERWRAENPDSVKYSIKYYKGLGTSSAKEAREYFTDIERHTIRFIYDGKASDESIDLAFAKNKADDRKIWIAENSKLMLSTTTDSS… |
| T1GDZ7 | 253-375 | None |
| A0A6A4GCK8 | 11-107 | None |
| A0A7R9PU81 | 94-173 | None |
| A0A0K0EEJ7 | 275-408 | None |
| A0A1W0XCM1 | 2-104 | None |
| A0A6P8WQY5 | 583-712 | None |
| A0A250XKH7 | 497-616 | None |
| A0A453PC30 | 93-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.