DPCstruct | MC11580
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 82 ± 6 aa |
| Standard deviation of domain lengths | 5.68 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 63.48 |
| Pfam Score | 85.00 |
| Assigned Pfam label(s) | CL0266- CL0632 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212CU10 | 31-114 | MNEIWLRCDNEKQYAHWMAACRLASKGKTMADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDINPECLVSPRYLKKYKNKQ |
| A0A182EYB3 | 1-91 | MSEMILKCDTEHQYARWMAACRLASRGKTMADASYQSEVDSIKKLLQMQSGVAGTQNNASKKNLAVELPPDFNVDEFVSQRYTRRAR… |
| A0A6G1QEI8 | 880-955 | None |
| G5C4Y0 | 162-246 | None |
| A0A0M3JE01 | 2-89 | None |
| A0A6I9YW77 | 571-647 | None |
| A0A673HFG0 | 217-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.