DPCstruct | MC1158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 154 ± 4 aa |
| Standard deviation of domain lengths | 4.39 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 89.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 37.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z0D4C9 | 1-155 | MNITFTLRDLLQLILFLLGIGVLGYLIAILNNVYKIVKNTSNIVESNSVELDTTIKRLPEITENVDNITKKVDEIIFDIKDDLSDVV… |
| D8FJR6 | 1-161 | MNQAFTLSDLLTFFLSVAGILVLVALFLTLLKVFKILKSVSEVLEKNREEIDTTISSLPEVMENVNGITKNVNKITDDATELVDNSK… |
| A0A847NHY2 | 1-156 | None |
| A0A0L0W8Q7 | 1-149 | None |
| A0A1H3NS34 | 1-149 | None |
| A0A7X9CNF4 | 1-149 | None |
| A0A3F3S4B8 | 1-156 | None |
| A0A847XGJ7 | 1-155 | None |
| A0A7V6TND8 | 1-149 | None |
| A0A1M5QKT7 | 1-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.