DPCstruct | MC11576
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 132 ± 16 aa |
| Standard deviation of domain lengths | 16.01 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 15.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1HFX5 | 7-145 | WHQIIIDDPACLPGKIIYDVIQVLLCKIEFKYVVLDDIEGAAQKGLIPILRGMENSVLELDEFMSIVREVQQFDFGDFFLFKEYPKK… |
| A0A8B0IDK5 | 3-135 | KIEIYGQDKEELSIDLEQVVQPIQTIEGYSWKILWIDGESETDEYSVFELQEVIDQQDGIIVDYEALVNLSHKMETVTEALIIGDRN… |
| A0A2D7NM38 | 67-213 | None |
| C2UAG7 | 1-115 | None |
| A0A351L1Z5 | 2-125 | None |
| A0A5C6ATH6 | 41-187 | None |
| A0A1I6X628 | 2-116 | None |
| A0A3R8MGN8 | 72-184 | None |
| A0A7W5VAT9 | 13-133 | None |
| A0A7U0A328 | 6-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.