DPCstruct | MC11574
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 287 ± 58 aa |
| Standard deviation of domain lengths | 58.25 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 77.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12816 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4YZD0 | 4-229 | CKQNGLYDGIIYVMNKALNDYLSPLEEMLTDVSSFASHEVMSDSEVERGNRLLLYLHCCLAGHAYPYGTLPPDQLCTVPTHVYRCIT… |
| A0A2H3JH96 | 434-775 | DLAERIIWHIDAECLDVNQAITLCQRHRLYDALLYVYTRALKDYVSPVVELIGLVRKVQQFRRARAEDLSSAPRAKEEEIEPVILNA… |
| A0A7D8Z266 | 321-610 | None |
| A0A3Q0KTA3 | 709-1068 | None |
| A0A7T8K0H8 | 125-373 | None |
| A0A3Q0J5Z7 | 483-731 | None |
| A0A287XQN4 | 284-591 | None |
| A0A0C2MDJ5 | 4-255 | None |
| C9SH74 | 321-653 | None |
| A0A175VTU1 | 746-1094 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.