DPCstruct | MC11573
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 167 ± 23 aa |
| Standard deviation of domain lengths | 23.48 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 24.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7LDJ1 | 1-149 | MSPQLEAVALRGLDIMKRNQLLEQTVNENEAKSLVSFFESEEPKPDKLVVALIDKALTYGVEVLLTRPDLFEDFVDNELRLFLIDAS… |
| A0A0N4YT51 | 1-193 | MRNSTLKWKHQPIINLFDDAHENERLMVAVKALAIMWFYKLFDEVLTKEEIQTLKAYFTSSSSNQDLMTVIPVIDKAIGHSMRIMRK… |
| A0A4X3P658 | 645-792 | None |
| H3E3F7 | 319-457 | None |
| A0A3P6Q5T0 | 1-152 | None |
| A0A016S8P0 | 77-274 | None |
| A0A016UJM0 | 153-342 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.