DPCstruct | MC11572
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 233 ± 44 aa |
| Standard deviation of domain lengths | 43.98 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 17.82 |
| Pfam Score | 98.84 |
| Assigned Pfam label(s) | CL0366- PF09808 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q4N706 | 33-192 | KAFQTDLQLFISNYCNQIFQNNFNTFLNSCLDFGLEGIGLEYRNRMFSKILVLSPKENLTDVWQILWGTWSYMFKNGVEEKSEEYNV… |
| A0A0N4YP90 | 14-251 | IVNDLEMLLEAFKSKQSVRLVKFHEVANHFELFTIYSGRMHVSELLEFAELLLKAAFDYTRPVRQCTMGNRTQRTLTERVFGVYATY… |
| A0A409VDX6 | 1-303 | None |
| A0A6V7XR07 | 5-271 | None |
| A0A5B1QR69 | 6-300 | None |
| A0A182JZC6 | 5-199 | None |
| W4GKR7 | 2-297 | None |
| A0A1J1HDQ2 | 31-275 | None |
| A0A0D8XPH5 | 26-283 | None |
| G0P2D2 | 1-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.