DPCstruct | MC11571
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 107 ± 6 aa |
| Standard deviation of domain lengths | 6.43 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 76.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D2XNJ2 | 1-90 | MADRNDDLLTRTSWCDARHAQKEIDRGRAHGNKAALWLRVRIQAFMFHIGCVVQQHYGKVLIMGMLILACLIVGIKFAVVETNVEKL… |
| A0A0N4YP08 | 44-147 | FVERKVIGNSDSADFTYAWKAKFSHAPTWCDADMSLQQIRRGVARGNRIALYARSAFQYILFQTGCFVQRWAWSTVVIGLFLYTVCC… |
| A0A183H810 | 60-171 | None |
| A0A4U8UTC6 | 101-209 | None |
| A0A6P3DYF8 | 27-137 | None |
| A0A3P7DVS5 | 54-162 | None |
| A0A2H2J239 | 2-105 | None |
| A0A2A2KEN1 | 61-163 | None |
| A0A0N5DBL4 | 11-120 | None |
| A0A6V7Y8U2 | 54-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.