DPCstruct | MC11570
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 184 ± 27 aa |
| Standard deviation of domain lengths | 27.32 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 66.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 24.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15335 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4YND4 | 1-161 | MSPKAVDHRSKHQRRSRSRSPLPDDLDVFTSLSSLATDHETLASAAVSFVGWRGVEKMLPPCLQGRSREDVIQLVSDELDGMSKKRI… |
| A0A6J1SHU9 | 2-196 | EMNSGTSQKLAKKRTHKKHKTVKRRKQNDSSGDESVDMSEDVFPIAHYISNRDQMIEQVFAVMEKEKLNCMLPPILKGLTLSALKES… |
| A0A2H2IJB9 | 2-196 | None |
| A0A3Q0ITT9 | 36-214 | None |
| A0A2G8KZT7 | 56-195 | None |
| A0A3S1BG38 | 1-170 | None |
| A0A834N254 | 1-150 | None |
| A0A3Q4BBB4 | 11-254 | None |
| A0A3B1JFV7 | 92-323 | None |
| A0A6F9D8Q0 | 36-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.