DPCstruct | MC11569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 153 ± 35 aa |
| Standard deviation of domain lengths | 35.34 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4YMJ5 | 71-211 | LKIFQKHITMAFQLFITDPPEEIQRYAIRIAGKSGRDMSLKTLPEEVETILIDFALDMLGYGQPEIKCRASVALEESRFFASLGSTY… |
| A0A016RSS3 | 551-700 | RRSGRATEEDHLTHCTDFMRFYLVRACDPVKSIQKYAHRVSGRGQKKEDLKDLPENIVGILIECLLDGLGLGQPELQMATEELEDRP… |
| W6NC36 | 2-123 | None |
| E3LPE1 | 749-910 | None |
| A0A016WQZ1 | 7-123 | None |
| A0A1I7UK62 | 23-229 | None |
| G0MNE2 | 85-309 | None |
| K7GXQ9 | 880-1087 | None |
| K7H105 | 88-272 | None |
| A0A3P6S6R9 | 6-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.